LYPD6 Antibody

Name LYPD6 Antibody
Supplier Novus Biologicals
Catalog NBP1-70629
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LYPD6(LY6/PLAUR domain containing 6) The peptide sequence was selected from the middle region of LYPD6. Peptide sequence RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LYPD6
Conjugate Unconjugated
Supplier Page Shop

Product images