LRRC56 Antibody

Name LRRC56 Antibody
Supplier Novus Biologicals
Catalog NBP1-70626
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LRRC56(leucine rich repeat containing 56) The peptide sequence was selected from the N terminal of LRRC56. Peptide sequence LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LRRC56
Conjugate Unconjugated
Supplier Page Shop

Product images