LRRC24 Antibody

Name LRRC24 Antibody
Supplier Novus Biologicals
Catalog NBP1-70622
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LRRC24(leucine rich repeat containing 24) The peptide sequence was selected from the N terminal of LRRC24. Peptide sequence PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LRRC24
Conjugate Unconjugated
Supplier Page Shop

Product images