LRP2BP Antibody

Name LRP2BP Antibody
Supplier Novus Biologicals
Catalog NBP1-70620
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LRP2BP(LRP2 binding protein) The peptide sequence was selected from the middle region of LRP2BP. Peptide sequence RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANKRD37
Conjugate Unconjugated
Supplier Page Shop

Product images