KLHL15 Antibody

Name KLHL15 Antibody
Supplier Novus Biologicals
Catalog NBP1-70593
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KLHL15(kelch-like 15 (Drosophila)) The peptide sequence was selected from the middle region of KLHL15. Peptide sequence VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KLHL15
Conjugate Unconjugated
Supplier Page Shop

Product images