Claudin-23 Antibody
| Name | Claudin-23 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70500 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CLDN23 (claudin 23) The peptide sequence was selected from the C terminal of CLDN23. Peptide sequence IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CLDN23 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: CLDN23 Antibody [NBP1-70500] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14594_CLDN23%2520Antibody-Western%2520Blot-NBP1-70500-img0001.jpg)
![Immunohistochemistry-Paraffin: CLDN23 Antibody [NBP1-70500] - Human Placenta Tissue, 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14595_CLDN23%2520Antibody-Immunohistochemistry-Paraffin-NBP1-70500-img0002.jpg)