FAM20C Antibody

Name FAM20C Antibody
Supplier Novus Biologicals
Catalog NBP1-70768
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM20C(family with sequence similarity 20, member C) The peptide sequence was selected from the C terminal of FAM20C. Peptide sequence NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM20C
Conjugate Unconjugated
Supplier Page Shop

Product images