DOC1 Antibody

Name DOC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70759
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FILIP1L(filamin A interacting protein 1-like) The peptide sequence was selected from the middle region of FILIP1L. Peptide sequence KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANAPC10
Conjugate Unconjugated
Supplier Page Shop

Product images