WDR35 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-70744
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to WDR35(WD repeat domain 35) Antibody(against the N terminal of WDR35. Peptide sequence SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: WDR35
• Conjugate: Unconjugated