| Name | VSIG8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70742 |
| Prices | $369.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to VSIG8(V-set and immunoglobulin domain containing 8) The peptide sequence was selected from the N terminal of VSIG8. Peptide sequence HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | VSIG8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |