TRAPPC2L Antibody

Name TRAPPC2L Antibody
Supplier Novus Biologicals
Catalog NBP1-70735
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRAPPC2L(trafficking protein particle complex 2-like) The peptide sequence was selected from the N terminal of TRAPPC2L. Peptide sequence MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRAPPC2L
Conjugate Unconjugated
Supplier Page Shop

Product images