TIGD3 Antibody

Name TIGD3 Antibody
Supplier Novus Biologicals
Catalog NBP1-70724
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TIGD3(tigger transposable element derived 3) The peptide sequence was selected from the N terminal of TIGD3. Peptide sequence NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene TIGD3
Conjugate Unconjugated
Supplier Page Shop

Product images