THNSL2 Antibody

Name THNSL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-70723
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to THNSL2(threonine synthase-like 2 (S. cerevisiae)) The peptide sequence was selected from the middle region of THNSL2. Peptide sequence LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene THNSL2
Conjugate Unconjugated
Supplier Page Shop

Product images