ST8SIA-VI Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-70716
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ST8SIA6(ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6) The peptide sequence was selected from the middle region of ST8SIA6. Peptide sequence LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVE
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ST8SIA6
• Conjugate: Unconjugated

Product images

Western Blot: ST8SIA-VI Antibody [NBP1-70716] - HT1080 cell lysate, concentration 0.2-1 ug/ml.