SLAIN1 Antibody

Name SLAIN1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70704
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLAIN1(SLAIN motif family, member 1) The peptide sequence was selected from the middle region of SLAIN1. Peptide sequence RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLAIN1
Conjugate Unconjugated
Supplier Page Shop

Product images