SARP Antibody

Name SARP Antibody
Supplier Novus Biologicals
Catalog NBP1-70701
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ANKRD42 (ankyrin repeat domain 42) The peptide sequence was selected from the N terminal of ANKRD42)(50ug). Peptide sequence MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANKRD42
Conjugate Unconjugated
Supplier Page Shop

Product images