PURB Antibody

Name PURB Antibody
Supplier Novus Biologicals
Catalog NBP1-70691
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PURB(purine-rich element binding protein B) The peptide sequence was selected from the N terminal of PURB. Peptide sequence MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PURB
Conjugate Unconjugated
Supplier Page Shop

Product images