PSTK Antibody

Name PSTK Antibody
Supplier Novus Biologicals
Catalog NBP1-70690
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PSTK(phosphoseryl-tRNA kinase) The peptide sequence was selected from the middle region of PSTK. Peptide sequence SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PSTK
Conjugate Unconjugated
Supplier Page Shop

Product images