PRRC1 Antibody

Name PRRC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70687
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PRRC1(proline-rich coiled-coil 1) The peptide sequence was selected from the middle region of PRRC1 (NP_570721). Peptide sequence VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PRRC1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.