FKBP13/FKBP2 Antibody
| Name | FKBP13/FKBP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79721 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Goat, Zebrafish |
| Antigen | Synthetic peptide directed towards the N terminal of human FKBP2The immunogen for this antibody is FKBP2. Peptide sequence RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FKBP2 |
| Supplier Page | Shop |
Product images
![Western Blot: FKBP2 Antibody [NBP1-79721] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8767_FKBP2%2520Antibody-Western%2520Blot-NBP1-79721-img0003.jpg)
Western Blot: FKBP2 Antibody [NBP1-79721] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.