ARHGAP20 Antibody
| Name | ARHGAP20 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79675 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human ARHGAP20The immunogen for this antibody is ARHGAP20. Peptide sequence YSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ARHGAP20 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ARHGAP20 Antibody [NBP1-79675] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14623_ARHGAP20%2520Antibody-Western%2520Blot-NBP1-79675-img0003.jpg)
Western Blot: ARHGAP20 Antibody [NBP1-79675] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.