PFKFB2 Antibody

Name PFKFB2 Antibody
Supplier Novus Biologicals
Catalog NBP1-79635
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the C terminal of human Pfkfb2The immunogen for this antibody is Pfkfb2. Peptide Sequence: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Pfkfb2
Conjugate Unconjugated
Supplier Page Shop

Product images