PRELP Antibody

Name PRELP Antibody
Supplier Novus Biologicals
Catalog NBP1-79627
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human PRELPThe immunogen for this antibody is PRELP. Peptide sequence SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PRELP
Conjugate Unconjugated
Supplier Page Shop

Product images