CYB5RL Antibody
| Name | CYB5RL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79619 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Rabbit |
| Antigen | Synthetic peptide directed towards the N terminal of human LOC606495. Peptide sequence KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CYB5RL |
| Supplier Page | Shop |
Product images
![Western Blot: CYB5RL Antibody [NBP1-79619] - HT1080 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8789_CYB5RL%2520Antibody-Western%2520Blot-NBP1-79619-img0002.jpg)
Western Blot: CYB5RL Antibody [NBP1-79619] - HT1080 cell lysate, concentration 0.2-1 ug/ml.