IER5L Antibody

Name IER5L Antibody
Supplier Novus Biologicals
Catalog NBP1-79610
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human IER5LThe immunogen for this antibody is IER5L. Peptide sequence SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene IER5L
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.