FAM131C Antibody

Name FAM131C Antibody
Supplier Novus Biologicals
Catalog NBP1-79607
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Zebrafish
Antigen Synthetic peptide directed towards the middle region of human FAM131CThe immunogen for this antibody is FAM131C. Peptide sequence RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene FAM131C
Supplier Page Shop

Product images