Evx1 Antibody
| Name | Evx1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79701 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human EVX1The immunogen for this antibody is EVX1. Peptide sequence PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EVX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Evx1 Antibody [NBP1-79701] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17240_Evx1%2520Antibody-Western%2520Blot-NBP1-79701-img0003.jpg)
Western Blot: Evx1 Antibody [NBP1-79701] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.