RAB23 Antibody
| Name | RAB23 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79647 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | Synthetic peptide directed towards the middle region of human Rab23The immunogen for this antibody is Rab23. Peptide sequence DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | Rab23 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RAB23 Antibody [NBP1-79647] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15425_RAB23%2520Antibody-Western%2520Blot-NBP1-79647-img0001.jpg)
Western Blot: RAB23 Antibody [NBP1-79647] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%