PPP2R5E Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-79638
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human PPP2R5EThe immunogen for this antibody is PPP2R5E. Peptide sequence QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PPP2R5E
• Conjugate: Unconjugated