FBXW9 Antibody
| Name | FBXW9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79823 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human FBXW9The immunogen for this antibody is FBXW9. Peptide sequence PDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FBXW9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FBXW9 Antibody [NBP1-79823] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15421_FBXW9%2520Antibody-Western%2520Blot-NBP1-79823-img0001.jpg)
Western Blot: FBXW9 Antibody [NBP1-79823] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%