UBL7 Antibody
| Name | UBL7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79757 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human UBL7The immunogen for this antibody is UBL7. Peptide sequence LQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UBL7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UBL7 Antibody [NBP1-79757] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16416_UBL7%2520Antibody-Western%2520Blot-NBP1-79757-img0003.jpg)
Western Blot: UBL7 Antibody [NBP1-79757] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.