ART1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-79795
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the C terminal of human ART1The immunogen for this antibody is ART1 (NP_004305). Peptide Sequence: KHSTYNCEYIKDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAF
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ART1
• Conjugate: Unconjugated

Product images

Western Blot: ART1 Antibody [NBP1-79795] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.