HHIPL1 Antibody
| Name | HHIPL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79777 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human HHIPL1The immunogen for this antibody is HHIPL1 (NP_001120730). Peptide sequence EFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HHIPL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HHIPL1 Antibody [NBP1-79777] - MDA-MB-435S cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16151_HHIPL1%2520Antibody-Western%2520Blot-NBP1-79777-img0002.jpg)
Western Blot: HHIPL1 Antibody [NBP1-79777] - MDA-MB-435S cell lysate, concentration 0.2-1 ug/ml.