Fascin 2 Antibody
| Name | Fascin 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79776 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptide directed towards the middle region of human FSCN2. Peptide sequence AGTLKAGRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FSCN2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Fascin 2 Antibody [NBP1-79776] - analysis of Fascin 2 in NRK whole cell lysate using anti-Fascin 2 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4875_Fascin-2-Antibody-Western-Blot-NBP1-79776-img0004.jpg)
![Western Blot: Fascin 2 Antibody [NBP1-79776] - Human Brain lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4876_Fascin-2-Antibody-Western-Blot-NBP1-79776-img0003.jpg)