NFKBID Antibody

Name NFKBID Antibody
Supplier Novus Biologicals
Catalog NBP1-79856
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptide directed towards the C terminal of human NFKBIDThe immunogen for this antibody is NFKBID. Peptide sequence QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene NFKBID
Supplier Page Shop

Product images