Name | NFKBID Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79856 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptide directed towards the C terminal of human NFKBIDThe immunogen for this antibody is NFKBID. Peptide sequence QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELP. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | NFKBID |
Supplier Page | Shop |