TM2D2 Antibody

Name TM2D2 Antibody
Supplier Novus Biologicals
Catalog NBP1-79845
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Goat
Antigen Synthetic peptide directed towards the middle region of human TM2D2The immunogen for this antibody is TM2D2. Peptide sequence QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TM2D2
Supplier Page Shop

Product images