FSD1L Antibody
| Name | FSD1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79841 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human FSD1LThe immunogen for this antibody is FSD1L. Peptide sequence KGQESKIKGKENKGRSGTPSPKRTSVGSRPPAVRGSRDRFTGESYTVLGD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FSD1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FSD1L Antibody [NBP1-79841] - THP-1 Cell Lysate 1ug/ml Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15486_FSD1L%2520Antibody-Western%2520Blot-NBP1-79841-img0001.jpg)
Western Blot: FSD1L Antibody [NBP1-79841] - THP-1 Cell Lysate 1ug/ml Gel Concentration 12%