EBF-3 Antibody

Name EBF-3 Antibody
Supplier Novus Biologicals
Catalog NBP1-79982
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human EBF3. Peptide sequence AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene EBF3
Conjugate Unconjugated
Supplier Page Shop

Product images