CHRNB3 Antibody

Name CHRNB3 Antibody
Supplier Novus Biologicals
Catalog NBP1-79950
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptide directed towards the middle region of human CHRNB3The immunogen for this antibody is CHRNB3. Peptide sequence YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CHRNB3
Supplier Page Shop

Product images