Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody

Name Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody
Supplier Novus Biologicals
Catalog NBP1-79947
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit
Antigen Synthetic peptide directed towards the N terminal of human CHRNA4. Peptide sequence ELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKW.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CHRNA4
Supplier Page Shop

Product images