WDR3 Antibody

Name WDR3 Antibody
Supplier Novus Biologicals
Catalog NBP1-79930
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human WDR3The immunogen for this antibody is WDR3. Peptide sequence VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WDR3
Conjugate Unconjugated
Supplier Page Shop

Product images