ADAMTS6 Antibody

Name ADAMTS6 Antibody
Supplier Novus Biologicals
Catalog NBP1-79877
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a.a. 563-897 of Human ADAMTS6 (NP_922932). Peptide Sequence: PWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTE
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADAMTS6
Conjugate Unconjugated
Supplier Page Shop

Product images