PIGC Antibody
| Name | PIGC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79871 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human PIGCThe immunogen for this antibody is PIGC. Peptide sequence AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PIGC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PIGC Antibody [NBP1-79871] - Titration: 1.0 ug/ml Positive Control: Fetal Lung.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7109_PIGC-Antibody-Western-Blot-NBP1-79871-img0003.jpg)
![Western Blot: PIGC Antibody [NBP1-79871] - Human 293T, Antibody Dilution: 1.0 ug/ml PIGC is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7110_PIGC%2520Antibody-Western%2520Blot-NBP1-79871-img0004.jpg)