Name | Agpat4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79870 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the middle region of human AGPAT4The immunogen for this antibody is AGPAT4 (NP_064518). Peptide Sequence: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | AGPAT4 |
Conjugate | Unconjugated |
Supplier Page | Shop |