Agpat4 Antibody

Name Agpat4 Antibody
Supplier Novus Biologicals
Catalog NBP1-79870
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human AGPAT4The immunogen for this antibody is AGPAT4 (NP_064518). Peptide Sequence: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AGPAT4
Conjugate Unconjugated
Supplier Page Shop

Product images