Name | Nicotinic Acetylcholine Receptor gamma Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79952 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the N terminal of human CHRNG. Peptide sequence NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CHRNG |
Conjugate | Unconjugated |
Supplier Page | Shop |