SEPN1 Antibody
| Name | SEPN1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79247 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human SEPN1The immunogen for this antibody is SEPN1. Peptide sequence ANYFLDITSVKPEEIESNLFSFSSTFEDPSTATYMQFLKEGLRRGLPLLQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SEPN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SEPN1 Antibody [NBP1-79247] - HeLa Cell Lysate, ANtibody titration used is 1.0ug/ml and Gel concentration is 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16861_SEPN1%2520Antibody-Western%2520Blot-NBP1-79247-img0001.jpg)
Western Blot: SEPN1 Antibody [NBP1-79247] - HeLa Cell Lysate, ANtibody titration used is 1.0ug/ml and Gel concentration is 12%