| Name | Emx1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79222 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human EMX1The immunogen for this antibody is EMX1. Peptide sequence DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EMX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |