Name | Emx1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79221 |
Prices | $369.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the middle region of human EMX1The immunogen for this antibody is EMX1. Peptide sequence DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | EMX1 |
Conjugate | Unconjugated |
Supplier Page | Shop |