SNX29 Antibody
| Name | SNX29 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79261 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human RUNDC2AThe immunogen for this antibody is RUNDC2A. Peptide sequence MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SNX29 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SNX29 Antibody [NBP1-79261] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24877_SNX29-Antibody-Western-Blot-NBP1-79261-img0005.jpg)
Western Blot: SNX29 Antibody [NBP1-79261] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: SNX29 Antibody [NBP1-79261] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24878_SNX29-Antibody-Immunohistochemistry-Paraffin-NBP1-79261-img0004.jpg)
Immunohistochemistry-Paraffin: SNX29 Antibody [NBP1-79261] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.