ABHD1 Antibody
| Name | ABHD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79333 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human ABHD1The immunogen for this antibody is ABHD1. Peptide sequence GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ABHD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ABHD1 Antibody [NBP1-79333] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16767_ABHD1%2520Antibody-Western%2520Blot-NBP1-79333-img0002.jpg)
Western Blot: ABHD1 Antibody [NBP1-79333] - HepG2 cell lysate, concentration 0.2-1 ug/ml.